PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC11550_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 501aa    MW: 54838.1 Da    PI: 9.9062
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC11550_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.31.4e-123898262
                 XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                 ++ ++  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  RrC11550_p1 38 EDERKRARLIRNRESAQLSRQRKKHYVEELEEKVRSMHSAITDLNGKISYFMAENAALRQQ 98
                 444556699***************************************9999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-1637101IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.2083999IPR004827Basic-leucine zipper domain
PfamPF001706.7E-114099IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.31E-124199No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-164199No hitNo description
CDDcd147041.14E-194293No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
TTKRKKEDTS ESDESRSSKY RRSGEQESAV TNIEEEEEDE RKRARLIRNR ESAQLSRQRK  60
KHYVEELEEK VRSMHSAITD LNGKISYFMA ENAALRQQLG GCPPPPIGMY PPMAYPWMPC  120
PPPYMVKQQG GQVPLIPIPR LKPQNTLGSS SSKGKSKKSE ARTKKVASIS FLGLLFCLFL  180
FGALAPIVNV DYGGISGAFY GNYRSSYVTD QVVYNQHRNR VLDTSRRDSA TESSVPPGNG  240
SEPLAASLFV PRNDKLVKID GNLIINSILA SEKAVASRKA SESNESSKAD GVIPKDRSLA  300
LPLPDVGMIE DMAKHLIRTK AEKQKALSSG SADTLNDSIK TKAANGEMQQ WFREGVAGPM  360
FSSGMCTEVF QFDVSSTSGA IIPASPATNV SSEHRKNATD THRRKNRRTL RGLAIPLPGS  420
DFNFTKEHQR NSSSKEIKPA SSMVVSVLVD PREGGDGDID GMIGGPKSLS RVFVVVLQDS  480
AKYVTYSCAL PRPGAPHLVT T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013687770.10.0PREDICTED: bZIP transcription factor 17-like
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A0D3C5J60.0A0A0D3C5J6_BRAOL; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein